Protein Info for mRNA_3663 in Rhodosporidium toruloides IFO0880

Name: 12031
Annotation: K01738 cysK cysteine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 73% identical to CYSK_NEUCR: Cysteine synthase 1 (cys-17) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K01738, cysteine synthase A [EC: 2.5.1.47] (inferred from 73% identity to uma:UM06345.1)

Predicted SEED Role

"Cysteine synthase B (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis (EC 2.5.1.47)

MetaCyc Pathways

superpathway of sulfate assimilation and cysteine biosynthesis (7/9 steps found)
L-cysteine biosynthesis I (1/2 steps found)
seleno-amino acid biosynthesis (plants) (2/5 steps found)
superpathway of seleno-compound metabolism (5/19 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.47

Use Curated BLAST to search for 2.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>mRNA_3663 K01738 cysK cysteine synthase A (Rhodosporidium toruloides IFO0880)
MVMLRATASARAAFRAANVLRSSSTAAPYNPPSPYSGVSFQPHPHSLPVDGFVGAVGNTP
LIRINSLSDETGCEVLGKAEFMNPGGSVKDRAALGLVKWAENTGRIKPGGTIVEGTAGNT
GIGLAHVCRAKGYKCVIYMPNTQSQEKIDLLRMLGAEVYPVPAVAFENPENYNHQARRHA
ERLDNAAWVNQFDNFEGNRAAHIHTTGPEIYAQTEHLPGGLTAFICATGTGGTLAGVTRA
LKDLSGGKIQCWLADPPGSVLESFINRGVMERGGGSITEGIGQGRVTDNLAQDIKLLDGA
LHIPDADTIRMIYHLLDKDGLYVGASTALNVVAAKQLAVKLGKGSRVVTILCDGAYRYQS
RLFSKKWLESKNLYQELPEHLQKYAVLP