Protein Info for mRNA_3667 in Rhodosporidium toruloides IFO0880

Name: 12035
Annotation: KOG3455 Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 transmembrane" amino acids 18 to 36 (19 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details PF03694: Erg28" amino acids 14 to 121 (108 residues), 142.5 bits, see alignment E=3.3e-46

Best Hits

Swiss-Prot: 44% identical to ERG28_SCHPO: Ergosterol biosynthetic protein 28 (erg28) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 52% identity to cci:CC1G_06386)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (137 amino acids)

>mRNA_3667 KOG3455 Predicted membrane protein (Rhodosporidium toruloides IFO0880)
MDKLAQYLPPTSGGNLPNWMLFVSGLAIFNGVQNYLTTRLTAQVYARRPTWVNPLQARLF
GVWTLMSAFVRLYAAYHIHSKPIYDLTLISYVLALGHFASEALVFRTVGLKGVFFPFVVA
SSSLYWMITQYDFYVRL