Protein Info for mRNA_3685 in Rhodosporidium toruloides IFO0880

Name: 12053
Annotation: KOG4212 RNA-binding protein hnRNP-M

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 PF00076: RRM_1" amino acids 125 to 192 (68 residues), 54.2 bits, see alignment E=1.1e-18 amino acids 256 to 324 (69 residues), 57.3 bits, see alignment E=1.1e-19 amino acids 413 to 480 (68 residues), 66 bits, see alignment E=2.2e-22

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (520 amino acids)

>mRNA_3685 KOG4212 RNA-binding protein hnRNP-M (Rhodosporidium toruloides IFO0880)
MADDYDRSERDRDQDDGHRERARSRSRSPRRRSPSPRRRSPSPRRSSHRDRSRSPRERSR
SRSPRRMDTDRERDRDRSDRDRDHRGGGGAGGGDRRAPFDPARKAMAREIAASEAAKRSR
KECRVYVGNLAFGVKWNDLKDFMREAGNVVFAEIMLLPNGMSKGCGVVEYSTPEEAQRAI
RELSDQQLLGRPVFVREDREDEARYGSAAISGRAGFMGQGAAFPARGGFGGGFGGRGGFA
GGAGFGGPVGGQGRHLYITGLPYTVGWQDLKDLFRAAGSIIRADVKMGPDGSHSGTGTVV
YETAQDAQNAIAMYNGFEFQGSVLEVREDRFPQGGHGGGGFGGRGGGFMGRGGFGGGFGR
GGFGGVAPGFGAGAYGYGAAGGFGAAGFGAGAGFGGVPAGPGGGAVMPPSQQIYVRNLPY
STSNEDLVELFQTTGTVEHAEVLFEHGRSKGAGIVQFATVEEAQTAITRFNGYQYGGRPL
ALDFNARWKPFGAPGAPTGTVDDATYDAGAVAGMEGVQAV