Protein Info for mRNA_3692 in Rhodosporidium toruloides IFO0880

Name: 12060
Annotation: K04371 MAPK1_3 mitogen-activated protein kinase 1/3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 PF00069: Pkinase" amino acids 30 to 326 (297 residues), 217 bits, see alignment E=4.7e-68 PF07714: Pkinase_Tyr" amino acids 32 to 244 (213 residues), 96.7 bits, see alignment E=2.2e-31

Best Hits

Swiss-Prot: 66% identical to MAPK_FUSSO: Mitogen-activated protein kinase (MAPK) from Fusarium solani subsp. pisi

KEGG orthology group: K04371, extracellular signal-regulated kinase 1/2 [EC: 2.7.11.24] (inferred from 74% identity to lbc:LACBIDRAFT_184962)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.11.24

Use Curated BLAST to search for 2.7.11.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>mRNA_3692 K04371 MAPK1_3 mitogen-activated protein kinase 1/3 (Rhodosporidium toruloides IFO0880)
MSTVPQRPAPAAPAPSSEKRKIRFSVGTEYKVEEIIGEGAYGVVCSATHVRTGVRVAIKK
VSPFDHSMFALRTLREVKLLRYFAENQVSENLITIVDVIKPSSYDSFKEVYLIQELMETD
LYRVIKTQQLSDDHVQYFVYQTLRALKALHSANVIHRDLKPSNLLLNANCDLKICDFGLA
RSVDTAEPSGGEAGGFMTEYVATRWYRAPEIMLSFKQYSKAIDIWSVGCICAEMLSGRPL
FPGRDYHHQLTLILSVTGTPMMDEFCRITSRRSRDYLRALPFQRKRPFAELFPNASPLAL
DFLAATLTFDPTKRITAEQALEHPYLAAYHDPTDEPTAPPLDPGFFDFDLDKPSREEIRK
LLYNEVMTFKRII