Protein Info for mRNA_3712 in Rhodosporidium toruloides IFO0880

Name: 12080
Annotation: K00003 E1.1.1.3 homoserine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF03447: NAD_binding_3" amino acids 10 to 154 (145 residues), 47.4 bits, see alignment E=2.9e-16 PF00742: Homoserine_dh" amino acids 168 to 385 (218 residues), 162.2 bits, see alignment E=1.2e-51

Best Hits

KEGG orthology group: K00003, homoserine dehydrogenase [EC: 1.1.1.3] (inferred from 53% identity to scm:SCHCODRAFT_79193)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.3

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>mRNA_3712 K00003 E1.1.1.3 homoserine dehydrogenase (Rhodosporidium toruloides IFO0880)
MTSCAVAIVGVGLVGKQVVHQLTSPALSPLFKIISLTNSRHTLHLNPAAPSLDGQTLLSL
LPPSSGPLPSSSTHPAASYVAANPTELVKKLAADARQSKQHTILIDCTSDLSVTELYPTA
IASGLSVVTPNKKGFSSSADLFKQIVEAQSAPNAGLVYLEATVGAGLPIISTLRDLLKTG
DEVTKIEGVFSGTMSYIFNEFSKPASGGAVGPKFSEIVKIAKENGYTEPHPADDLSGSDV
ARKLTILSRLLSINPSSLAALPDLPEGYASLSTETLIPSALANIASGEEFVQKLPEHDAE
FDKLRSEAEAEGKVLRYVGVIDRASGVVKCGLEKYPAAHPFASALSGSDNIVAFHTKRYS
QRPLIVQGAGAGADVTAMGVVADAIKVAERQGVRVHL