Protein Info for mRNA_3712 in Rhodosporidium toruloides IFO0880

Name: 12080
Annotation: K00003 E1.1.1.3 homoserine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03447: NAD_binding_3
  • amino acids 10 to 154 (145 residues), 47.4 bits, E=2.9e-16
• PF00742: Homoserine_dh
  • amino acids 168 to 385 (218 residues), 162.2 bits, E=1.2e-51

Best Hits

KEGG orthology group: K00003, homoserine dehydrogenase [EC: 1.1.1.3] (inferred from 53% identity to scm:SCHCODRAFT_79193)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (10/15 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (10/18 steps found)
• aspartate superpathway (15/25 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.3

Use Curated BLAST to search for 1.1.1.3

Protein Sequence (397 amino acids)

>mRNA_3712 K00003 E1.1.1.3 homoserine dehydrogenase (Rhodosporidium toruloides IFO0880)
MTSCAVAIVGVGLVGKQVVHQLTSPALSPLFKIISLTNSRHTLHLNPAAPSLDGQTLLSL
LPPSSGPLPSSSTHPAASYVAANPTELVKKLAADARQSKQHTILIDCTSDLSVTELYPTA
IASGLSVVTPNKKGFSSSADLFKQIVEAQSAPNAGLVYLEATVGAGLPIISTLRDLLKTG
DEVTKIEGVFSGTMSYIFNEFSKPASGGAVGPKFSEIVKIAKENGYTEPHPADDLSGSDV
ARKLTILSRLLSINPSSLAALPDLPEGYASLSTETLIPSALANIASGEEFVQKLPEHDAE
FDKLRSEAEAEGKVLRYVGVIDRASGVVKCGLEKYPAAHPFASALSGSDNIVAFHTKRYS
QRPLIVQGAGAGADVTAMGVVADAIKVAERQGVRVHL