Protein Info for mRNA_3714 in Rhodosporidium toruloides IFO0880

Name: 12082
Annotation: K14006 SEC23 protein transport protein SEC23

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 768 PF04810: zf-Sec23_Sec24" amino acids 59 to 98 (40 residues), 59.5 bits, see alignment 6.4e-20 PF04811: Sec23_trunk" amino acids 127 to 394 (268 residues), 236.6 bits, see alignment E=8.1e-74 PF08033: Sec23_BS" amino acids 405 to 507 (103 residues), 101.3 bits, see alignment E=1e-32 PF04815: Sec23_helical" amino acids 520 to 618 (99 residues), 90 bits, see alignment E=2.1e-29 PF00626: Gelsolin" amino acids 633 to 720 (88 residues), 42.1 bits, see alignment E=1.7e-14

Best Hits

Swiss-Prot: 79% identical to SEC23_USTMA: Protein transport protein SEC23 (SEC23) from Ustilago maydis (strain 521 / FGSC 9021)

KEGG orthology group: K14006, protein transport protein SEC23 (inferred from 79% identity to uma:UM01624.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (768 amino acids)

>mRNA_3714 K14006 SEC23 protein transport protein SEC23 (Rhodosporidium toruloides IFO0880)
MSGPRAFDFEEVEDRDGVRLSWNVWAGSRIEATRTVVPIGALYTPLKDRPDLPPVLYEPV
TCKAPCRAILNPYCQIDVRGKLWICPFCLQRNAFPPHYKDISNNNLPAELLPQYTTIEYT
LSRPAQIPPIFLLVVDTCLEEDDLKSLKEALVVAINDMPPHALVGLITYGTMAQVHELGY
TECPKSFVFRGTKEYTTKSIMEMLGLAPPTRQGGPGGPPPNAPPPALSGAARFLLPVSQV
EYSLTTILETLQKDAWPVPSDKRAQRCTGVAMSVAVGLLETTFPNTGARIMLFTGGPATE
GPGMVVGVELREPIRSHHDIERDNVKYFKRATKFYEALARRAAQNGHAIDIFIGCLDQVG
LLEMKTLSNFTNGFMVLADSFSMQLFKASLRRVFAKDDQGHLQMGFNATFDVQTTKELKV
SGLIGHAISANKKSAWVGETEIGIGQTSAWKICSLTPRTANAVYFEVVTPAGQPLAPGAR
GTIQFVTHYQHSSGQYRLRVTTIARNFAEPGNPAISDNFDQEAAAVLMARIATYKAEIDD
SPDVLRWLDRMLIRLCQKFAEYRKDDPSSFRLNENFVIYPQFMFHLRRSQFLQVFNNSPD
ETAYYRHILNSEDVNNSLIMIQPTLMSYALEAQPEAVLLDSISIQPDRILLLDTFFHILI
FHGDTIAQWRKAGYQDQEGYENLRDLLKLPHEDAQDLLADRFPLPRYVQTDQGGSQARFL
LSKLNPSTTHASGGQYGQPPVGAAIFTDDVSLQVFMEHLKKLAVTGSS