Protein Info for mRNA_3722 in Rhodosporidium toruloides IFO0880

Name: 12090
Annotation: K11251 H2A histone H2A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 PF00125: Histone" amino acids 11 to 93 (83 residues), 64.5 bits, see alignment E=2e-21 PF00808: CBFD_NFYB_HMF" amino acids 29 to 92 (64 residues), 25.7 bits, see alignment E=1.7e-09 PF16211: Histone_H2A_C" amino acids 96 to 128 (33 residues), 63.7 bits, see alignment E=1.5e-21

Best Hits

Swiss-Prot: 84% identical to H2A_PHANO: Histone H2A (HTA1) from Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)

KEGG orthology group: K11251, histone H2A (inferred from 84% identity to pno:SNOG_14611)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (137 amino acids)

>mRNA_3722 K11251 H2A histone H2A (Rhodosporidium toruloides IFO0880)
MSSGGKSGGKAGGDSSSKAQSRSAKAGLQFPVGRIHRLLRNGNYAQRIGAGAPVYLAAVL
EYLAAEILELAGNAARDNKKSRIIPRHLQLAIRNDEELNRLLGHVVISQGGVLPNIHSEL
LPSKTKIGKDGKPSQEL