Protein Info for mRNA_3730 in Rhodosporidium toruloides IFO0880

Name: 12098
Annotation: KOG1268 Glucosamine 6-phosphate synthetases, contain amidotransferase and phosphosugar isomerase domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01380: SIS
  • amino acids 44 to 89 (46 residues), 28.4 bits, 6.5e-11
  • amino acids 132 to 262 (131 residues), 86 bits, E=1e-28

Predicted SEED Role

"Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.6.1.16)

MetaCyc Pathways

• UDP-N-acetyl-D-glucosamine biosynthesis II (5/6 steps found)
• chitin biosynthesis (7/9 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (3/5 steps found)
• O-antigen building blocks biosynthesis (E. coli) (7/11 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis III (2/6 steps found)
• CMP-legionaminate biosynthesis I (1/10 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (4/25 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Glutamate metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.16

Use Curated BLAST to search for 2.6.1.16

Protein Sequence (280 amino acids)

>mRNA_3730 KOG1268 Glucosamine 6-phosphate synthetases, contain amidotransferase and phosphosugar isomerase domains (Rhodosporidium toruloides IFO0880)
MRPLSIRWAKEDGRRPLSDSLLSTAPIRSPQALLLPLIFCSRLGVVNVVGSTISRESHCG
IHVNAGPEIGVASTKAYTSQYIALVMMAIQLSEDRLSMTARRNSIIDGLHELPGQIRAIL
QHDSEFQAIAPMLAKQTSLLIMGRGYQHATCLEAALKIKELSYLHSEGILAGELKHGPLA
LIDESMPVILVMTQDSIYPKVRSALEQVTARKGAPIIIANDTDPSFDDGRHRVIRVPRTV
DCLQGILNIIPLQLLSYHVAIARGCNVDMPRNLAKSVTVE