Protein Info for mRNA_3730 in Rhodosporidium toruloides IFO0880

Name: 12098
Annotation: KOG1268 Glucosamine 6-phosphate synthetases, contain amidotransferase and phosphosugar isomerase domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 33 to 49 (17 residues), see Phobius details PF01380: SIS" amino acids 44 to 89 (46 residues), 28.4 bits, see alignment 6.5e-11 amino acids 132 to 262 (131 residues), 86 bits, see alignment E=1e-28

Best Hits

Predicted SEED Role

"Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.6.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.16

Use Curated BLAST to search for 2.6.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>mRNA_3730 KOG1268 Glucosamine 6-phosphate synthetases, contain amidotransferase and phosphosugar isomerase domains (Rhodosporidium toruloides IFO0880)
MRPLSIRWAKEDGRRPLSDSLLSTAPIRSPQALLLPLIFCSRLGVVNVVGSTISRESHCG
IHVNAGPEIGVASTKAYTSQYIALVMMAIQLSEDRLSMTARRNSIIDGLHELPGQIRAIL
QHDSEFQAIAPMLAKQTSLLIMGRGYQHATCLEAALKIKELSYLHSEGILAGELKHGPLA
LIDESMPVILVMTQDSIYPKVRSALEQVTARKGAPIIIANDTDPSFDDGRHRVIRVPRTV
DCLQGILNIIPLQLLSYHVAIARGCNVDMPRNLAKSVTVE