Protein Info for mRNA_3748 in Rhodosporidium toruloides IFO0880

Name: 12116
Annotation: K00658 DLST, sucB 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 49 to 120 (72 residues), 67.1 bits, E=2e-22
• TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
  • amino acids 49 to 442 (394 residues), 509.9 bits, E=2.9e-157
• PF00198: 2-oxoacid_dh
  • amino acids 210 to 441 (232 residues), 272.9 bits, E=4.4e-85

Best Hits

Swiss-Prot: 53% identical to ODO2_SCHPO: Probable dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (kgd2) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 66% identity to cci:CC1G_07689)

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Lysine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.61

Protein Sequence (445 amino acids)

>mRNA_3748 K00658 DLST, sucB 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) (Rhodosporidium toruloides IFO0880)
MRPRSPSVRPSLPAVTALARRRPRLRRGLLWLNLDGQRLTDLCPADEIVKVPSMAESITE
GTLKQWLKQKGDYVEADEEVATIETDKIDVAVNAPKAGVLTELLANEEDTVAVGQDLFKL
DPNGKAEGGAKKEEAPKEEPKQDEPKKEEPKKDESKPEPKKEEAIPEAKSEYRKPDSAQP
APKAPEPSKKEEGKTAAQSPAAAAPKGSRNETRVKMSRMRARIAERLKEAQNTAASLTTF
NEIDMSALMAFRAKYKEQVLKDHGVKLGFMSAFVKASTIALREFPAVNASIEGTGTSAEI
VYRDYADVSVAVSTPKGLVTPVLRNAEQYNFVEIEREIANLGKKARDGKLTLEDMNGGTF
TISNGGVFGSLYGTPILNPPQCAVLGMHAINDKAVVTADKQIVVRPVMVAALTYDHRVID
GREAVSFLVLVKKLIEDPALLNLYN