Protein Info for mRNA_3750 in Rhodosporidium toruloides IFO0880

Name: 12118
Annotation: K13421 UMPS uridine monophosphate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00215: OMPdecase
  • amino acids 33 to 251 (219 residues), 249.1 bits, E=2e-78
• TIGR01740: orotidine 5'-phosphate decarboxylase
  • amino acids 35 to 257 (223 residues), 191.1 bits, E=1.1e-60

Best Hits

Swiss-Prot: 64% identical to PYRF_SCHCO: Orotidine 5'-phosphate decarboxylase (URA1) from Schizophyllum commune

KEGG orthology group: K01591, orotidine-5'-phosphate decarboxylase [EC: 4.1.1.23] (inferred from 64% identity to ppl:POSPLDRAFT_88293)

MetaCyc: 51% identical to orotidine-5'-phosphate decarboxylase (Saccharomyces cerevisiae S288C)
Orotidine-5'-phosphate decarboxylase. [EC: 4.1.1.23]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (7/9 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.23

Protein Sequence (279 amino acids)

>mRNA_3750 K13421 UMPS uridine monophosphate synthetase (Rhodosporidium toruloides IFO0880)
MPSITTRTYAERAAKHPIPVAKQLLDICDRKKTNLCVSVDVTSKAGLLRIAEAAGPYCCC
IKTHIDIVEDFDQDLVQQLQALADKHDFLIWEDRKFADIGNTVRLQYSSGIYKIASWAHI
TNAHLVPGEGILTGLASVGQPLGRGLLLLAEMSAKGNLATGEYTTKNVEAARRHPEFVMG
FVAMRRVDEREETAGGVAPGEGADYVIMTPGVGLDSKGDGMGQQYRTPDEVIRGSGCDVI
IVGRGIYGGGDGNPNEEIVKQCKRYQEAGWKAYEDRLRQ