Protein Info for mRNA_3768 in Rhodosporidium toruloides IFO0880

Name: 12136
Annotation: HMMPfam-Protein of unknown function (DUF1275)-PF06912

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 signal peptide" amino acids 12 to 15 (4 residues), see Phobius details amino acids 30 to 32 (3 residues), see Phobius details transmembrane" amino acids 16 to 29 (14 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details PF06912: DUF1275" amino acids 21 to 222 (202 residues), 117.2 bits, see alignment E=4.6e-38

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>mRNA_3768 HMMPfam-Protein of unknown function (DUF1275)-PF06912 (Rhodosporidium toruloides IFO0880)
MGRRLRWRDDIPSKAFVAPLTAVSFVTGLLDATTYASFGTFASAQTGNVIILIISIIHAL
KEARPINTTASLVAYVICGGLGGQIANLVGTRIRWWVMLSCFLQVILLAVPTGLVFRHVL
DPDVQNDQWVILLLLAASSGFQIAIARTCGVGEIPTAMLSTPIADLITDPALFKPQLYGQ
PVTGRNLFSIVSGTVVGAWMHRRTGFRWTLLLGTILRTVMLAWVAVLPAETQKEATERMS
IERSTSRGRWKNGLHREMLGIEEEP