Protein Info for mRNA_3771 in Rhodosporidium toruloides IFO0880

Name: 12139
Annotation: K02866 RP-L10e, RPL10 large subunit ribosomal protein L10e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR00279: ribosomal protein uL16" amino acids 2 to 171 (170 residues), 265.9 bits, see alignment E=6.5e-84 PF00252: Ribosomal_L16" amino acids 11 to 165 (155 residues), 159.5 bits, see alignment E=2.2e-51

Best Hits

Swiss-Prot: 75% identical to RL10A_SCHPO: 60S ribosomal protein L10-A (rpl1001) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K02866, large subunit ribosomal protein L10e (inferred from 83% identity to lbc:LACBIDRAFT_192765)

Predicted SEED Role

"LSU ribosomal protein L10e (L16p)" in subsystem Ribosome LSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>mRNA_3771 K02866 RP-L10e, RPL10 large subunit ribosomal protein L10e (Rhodosporidium toruloides IFO0880)
GRRPARCYRYCKNKPYPKSRYNRGVPDPKIRIFDLGRKKASVDDFPFCAHLVSNEYEQLS
SEALEAARICANKYVVKNSGKDSFHLRVRAHPFHVIRINKMLSCAGADRLQTGMRGAWGK
PYGTVARVNIGQIILSIRCKDSNKAIVLEALRRAQYKFPGRQKIIISKKWGFTNLSREEY
LEKRSIAQPDGAYVQFVKPHGPLEDNLRRLERIGA