Protein Info for mRNA_3790 in Rhodosporidium toruloides IFO0880

Name: 12158
Annotation: K07151 STT3 dolichyl-diphosphooligosaccharide--protein glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 795 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 153 to 169 (17 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 202 to 205 (4 residues), see Phobius details amino acids 210 to 238 (29 residues), see Phobius details amino acids 247 to 271 (25 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 396 to 414 (19 residues), see Phobius details amino acids 420 to 440 (21 residues), see Phobius details amino acids 522 to 543 (22 residues), see Phobius details PF02516: STT3" amino acids 23 to 548 (526 residues), 443.1 bits, see alignment E=8.1e-137

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (795 amino acids)

>mRNA_3790 K07151 STT3 dolichyl-diphosphooligosaccharide--protein glycosyltransferase (Rhodosporidium toruloides IFO0880)
MATSYAYPPLPLSVEASDTLRSFLRVVILCLIAGAAVASREFAVVRFESIIHEFDPWFNY
RATRVLTEEGFYAFWNWFDPTAWYPLGRVVGGTLYPGLMVTSGLIWKVLHMLSIPVDIRE
VCVQLAPAFSGLTALATYFFAKEVGKEGSREGTGLWAALFIAIAPGYISRSVAGSYDNEA
IAIFILMITFCLWIKTVKTGSVLWAGVTALFYFYMVAAWGGYAFITNMLPLHVFVLLLMG
RYSSRLYVAYSSFYAIGTLASMQVPFVGFLPLLTSEHMGPLGVFGLLQIVAFVTLVKSLV
SEQHFRLLFRSFLGLGVALAVGGLWFMTKSGKIAPWTGRFYSLWDTGYARIHLPLVSSVS
EHQPTAWPSFFFDLQMLMYLFPAGVYICFRELRDEHVFVIIYSVLASYFAGVMVRLMLTL
TPVVCVTAAVAISSVYETYLDPREPDQGAKSTVTPAAAKQAVVGEVEAIAAAIEASAPST
PSKKGKRAAATPKADAPAASTSFASADSKTRHFGIIGLDSRFIPVIAFTFISFLFVLHCT
WVTSSAYSSPSVVLASRGPDGQQNIIDDFREAYYWLRQNTKEDAKVMSWWDYGYQIAGFS
NRTTLVDNNTWNNTHIATVGKIMSVREEVAYPILRKHDVDYVLVIFGGLLGFSGDDINKF
LWMVRISEGIWPDEVNEQKYFTPRGEYRVDDQASDTMKNSLMYKMSYYRFNELYGGGPAQ
DRVRQQAIPPVPIQLDTLEEAFTSENWIVRIYAVKKEDNLGRDHRSANAFLQGKRKKRSR
TPASSSAAKVKRKAA