Protein Info for mRNA_3802 in Rhodosporidium toruloides IFO0880

Name: 12170
Annotation: K01939 purA, ADSS adenylosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00709: Adenylsucc_synt
  • amino acids 12 to 430 (419 residues), 572.6 bits, E=2.6e-176
• TIGR00184: adenylosuccinate synthase
  • amino acids 12 to 433 (422 residues), 548.7 bits, E=4.4e-169

Best Hits

Swiss-Prot: 75% identical to PURA_USTMA: Adenylosuccinate synthetase (UMAG_03851) from Ustilago maydis (strain 521 / FGSC 9021)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 75% identity to uma:UM03851.1)

MetaCyc: 65% identical to Ade12 (Saccharomyces cerevisiae)
Adenylosuccinate synthase. [EC: 6.3.4.4]

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotide salvage (14/14 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (21/26 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.4

Protein Sequence (435 amino acids)

>mRNA_3802 K01939 purA, ADSS adenylosuccinate synthase (Rhodosporidium toruloides IFO0880)
MALSATPGKASVVLGAQWGDVRKGKLVDILAANADICARCAGGNNAGHTIVANIDGKKTK
FDFHLLPSGLVNPECTAFIGNGVVVHVPSFFQELDTLISKGLNCDGRLFVSDRAHLVFDF
HQIVDGLKEVELGGSSIGTTKKGIGPAYSSKSSRSGLRVHHLFDEEAFAAKFRKLVEGRF
KRYGHFEYDTEGEIVRYKELAKRLKPFVVDGPSFIHNALANNKRILVEGANALMLDLDFG
TYPYVTSSATGIGGVCTGLGLPPRAIGETIGVIKAYTTRVGAGPFPTEQLNKIGEHLQEV
GAEFGVTTGRRRRCGWLDLVVMKYSNLINGYTSLNLTKLDVLDDLETIQVGVAYHLDGKP
LDAFFPADLDTVARVEVQYVELPGWKQSIQEVKRWEDLPKACQEYVEYIEKFLGVPIEYI
GTGPARESMIVRKKN