Protein Info for mRNA_3893 in Rhodosporidium toruloides IFO0880

Name: 12261
Annotation: K07375 TUBB tubulin beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10644: Misat_Tub_SegII
  • amino acids 2 to 83 (82 residues), 28.9 bits, E=1.9e-10
• PF00091: Tubulin
  • amino acids 3 to 211 (209 residues), 232 bits, E=1.1e-72
• PF03953: Tubulin_C
  • amino acids 261 to 382 (122 residues), 144.9 bits, E=2.2e-46

Best Hits

Swiss-Prot: 82% identical to TBB_MELLI: Tubulin beta chain (TUB1) from Melampsora lini

KEGG orthology group: K07375, tubulin beta (inferred from 82% identity to lbc:LACBIDRAFT_294746)

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

• folate polyglutamylation (5/5 steps found)
• folate transformations III (E. coli) (7/9 steps found)
• glycine biosynthesis I (1/1 steps found)
• superpathway of L-serine and glycine biosynthesis I (3/4 steps found)
• folate transformations II (plants) (8/11 steps found)
• dTMP de novo biosynthesis (mitochondrial) (2/3 steps found)
• folate transformations I (9/13 steps found)
• photorespiration (6/9 steps found)
• glycine betaine degradation I (4/7 steps found)
• glycine betaine degradation II (mammalian) (1/4 steps found)
• purine nucleobases degradation II (anaerobic) (14/24 steps found)
• formaldehyde assimilation I (serine pathway) (6/13 steps found)

KEGG Metabolic Maps

• Cyanoamino acid metabolism
• Glycine, serine and threonine metabolism
• Methane metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.1

Use Curated BLAST to search for 2.1.2.1

Protein Sequence (449 amino acids)

>mRNA_3893 K07375 TUBB tubulin beta (Rhodosporidium toruloides IFO0880)
MREIVHLQTGQCGNQIGTKFWETITEEHGIDGQGVYRGDNDLQLERLDVYFNEASDRKYV
PRAVLVDLEPGTMDVIRAGPLGGLFRPDNMVSAQNGAGNNWAKGHYTEGAELVDSVLDVV
RKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRMMATFSVVPSPKVSDTVT
EPYNATLSVHQLVENSDETFCIDNEALYDICFRTLKLTSPTHGDLNQLVSVVMSGITTCL
RFPGQLNSDLRKLAVNMVPFPRLHFFMVGFAPLTAKGSQSFRAVSVPELTQQMFDAKNMM
AASDPRHGRYLTVAAFYRGKVSMREVDDSMLQVQTKNADHFVEWIPNNIQTAHCDIPPKG
LKMSVTFIGNSTSIQELFSRVHTQFSAMFRRRAFLHWYTGEGMDEMEFTEAESNMQDLVA
EYQQYESQGADDEYEGEYEENGAEEYAQE