Protein Info for mRNA_3906 in Rhodosporidium toruloides IFO0880

Name: 12274
Annotation: K03495 gidA, mnmG, MTO1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 706 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 56 to 676 (621 residues), 753.9 bits, see alignment E=6e-231 PF01134: GIDA" amino acids 58 to 456 (399 residues), 510.5 bits, see alignment E=3.5e-157 PF13932: GIDA_assoc" amino acids 459 to 670 (212 residues), 229.3 bits, see alignment E=5.9e-72

Best Hits

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 57% identity to bfu:BC1G_11669)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (706 amino acids)

>mRNA_3906 K03495 gidA, mnmG, MTO1 tRNA uridine 5-carboxymethylaminomethyl modification enzyme (Rhodosporidium toruloides IFO0880)
MLRRAALRASLYAIPPRSGAPSAAAARPRPATTIRTRLFATEVPSTPLNPDVQPYETLVI
GGGHAGCEAAAASARAGARTLLLTQRLDTIGEMSCNPSFGGIGKGTLVREVDALDGLCGK
ICDKAGIQFHVLNKSKGPAVYGYRAQIDRKLYKNEMQAVLSSYPNLDIRKAAVQDIVLSP
PREGEDARTGRKIVGLRLDTGEVIPCKSIVICTGTFLDSELHIGMDIIPKKGRINEASTH
TLSDSLREAGFELGRLKTGTPPRLAKDSINYEGMSEQVGDNPAKPFSFLTDRVANQDNQI
SCYQTATNEASHAIIRDNIHRTVHVRETVKGPRYCPSIESKVLRFGDKLSHVVWLEPEGY
DSDLIYPNGISITLPAEQQLEFLRTIRGLENVEMVQPGYGVEYDHIDPRELKHTLETKRI
SGLFLAGQINGTTGYEEAAAQGVLAGINAGRAALGEEQLTLSRADGFIGVMVDDLVTKGV
NEPYRMFTSRSEYRVSLRADNADLRLTEKGRSVGIVADARWAAYQSTKADIDEGIKMMEE
HKMTPDWWCTRGFDVSRDGQRRSAFELLHYKDIDVERLLPHVPGLETLPPRILERVGIAG
KYKQHIIRQMHEISLFLRDENLAIDESVDYDTMPGMSSEVRYRLKMARPATLGQAKRLEG
VTPASLASLMKYVRNRAARKAQLQQAAAVVDSDPSVRGEAGAILGM