Protein Info for mRNA_3911 in Rhodosporidium toruloides IFO0880

Name: 12279
Annotation: K18655 DDX19, DBP5 ATP-dependent RNA helicase DDX19/DBP5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00270: DEAD
  • amino acids 107 to 271 (165 residues), 116.5 bits, E=1.2e-37
• PF00271: Helicase_C
  • amino acids 318 to 426 (109 residues), 99.4 bits, E=1.6e-32

Best Hits

Swiss-Prot: 68% identical to DBP5_SCHPO: ATP-dependent RNA helicase dbp5 (dbp5) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01529, [EC: 3.6.1.-] (inferred from 68% identity to spo:SPBC12C2.06)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (476 amino acids)

>mRNA_3911 K18655 DDX19, DBP5 ATP-dependent RNA helicase DDX19/DBP5 (Rhodosporidium toruloides IFO0880)
MASDAVNSLASRLSALEPKQDGAVAAEKAAESPAEAPQAQEEQAEEPSLPHASSLLENLS
HEVQVTLADQQADPNSPLFSAKSFEDLNLHPDLLKGVYKMGFQKPSKIQEKALPLLLQNP
PRNMIGQSQSGTGKTAAFALTMLSRIDMDLKVPQAICIAPSRELAMQILSVVQKMGQYTP
VECFFAGKDSWQRGMPKLTQQIVIGTPGTMIDMVTKGRVLDLKEVKVFVLDEADNMLETG
SMADQSISLKNLITKMAKNPQIVLFSATFADIVRTFAERFAPGANEIRLKQEELSLDAIK
QFFMDCDDEEHKYLVLVELYNLLTIGQSIIFVKRRDTADEIARRMTAEGHKVVSLHGKLE
TAERDAVMESFRDGKTKVLITTNVIARGIDVSQVNMVVNYDLPLDAQGRPDPETYLHRIG
RTGRFGRQGVSINFVHDRRSFEHMEAIRAALGKPIVRVDTSDFEQMEKTLKAALKS