Protein Info for mRNA_3927 in Rhodosporidium toruloides IFO0880

Name: 12295
Annotation: K10734 GINS3 GINS complex subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF05916: Sld5" amino acids 46 to 156 (111 residues), 33 bits, see alignment E=3.7e-12

Best Hits

Swiss-Prot: 39% identical to PSF3_CRYNJ: DNA replication complex GINS protein PSF3 (PSF3) from Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)

KEGG orthology group: K10734, GINS complex subunit 3 (inferred from 36% identity to cci:CC1G_00114)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>mRNA_3927 K10734 GINS3 GINS complex subunit 3 (Rhodosporidium toruloides IFO0880)
MASWYSVTDFLDDATKLPSKVLLDIPNAGHLEGGTDKDLRAGTSLELPFWLASKLSEQDA
IDLTLPRAYSPMVRNALSASPESVHLRNLGGGGGAFYAGGMRLLSLIEDPTLSTILDHSF
KTRLVQIMDQSQHSLADHGGEGAAYEFAQGLDLWEKELFTVGETSAKQMKTWFDTKAKKR