Protein Info for mRNA_3932 in Rhodosporidium toruloides IFO0880

Name: 12300
Annotation: K18532 AK6, FAP7 adenylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13238: AAA_18
  • amino acids 9 to 137 (129 residues), 95.6 bits, E=1.8e-31

Best Hits

KEGG orthology group: K14535, transcription initiation factor TFIID subunit 9 / adenylate kinase [EC: 2.7.4.3] (inferred from 59% identity to scm:SCHCODRAFT_39938)

Predicted SEED Role

"AMP/CMP kinase AK6" in subsystem ZZ gjo need homes

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotide salvage (14/14 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (21/26 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.3

Use Curated BLAST to search for 2.7.4.3

Protein Sequence (187 amino acids)

>mRNA_3932 K18532 AK6, FAP7 adenylate kinase (Rhodosporidium toruloides IFO0880)
MSTRQWPNILITGTPGTGKTTHAAQLLEALQAAPSTSTAPWQHVNVGDFVKEKQCHSGWN
EEWQSWDVDEDKLLDALEVVQQPGAKILDWHTCDMFPERWIDLVVVLRCDHSQLWSRLEK
RGYALNKLQENNEAEIMEVILQDARESYAEEIVVELRSESPEEMEENIGRIVAWVEAWRR
DHVDDEP