Protein Info for mRNA_3939 in Rhodosporidium toruloides IFO0880

Name: 12307
Annotation: K13954 yiaY alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00465: Fe-ADH
  • amino acids 10 to 345 (336 residues), 239.5 bits, E=5.2e-75
• PF13685: Fe-ADH_2
  • amino acids 16 to 254 (239 residues), 31.5 bits, E=1.6e-11

Best Hits

Swiss-Prot: 52% identical to LINF_SPHJU: Maleylacetate reductase (linF) from Sphingobium japonicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S)

KEGG orthology group: None (inferred from 59% identity to mmw:Mmwyl1_1418)

MetaCyc: 52% identical to maleylacetate reductase / 2-chloromaleylacetate reductase (Sphingobium japonicum)
Maleylacetate reductase. [EC: 1.3.1.32]; 1.3.1.32 [EC: 1.3.1.32]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• ethanol degradation II (3/3 steps found)
• pyruvate fermentation to ethanol II (2/2 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• acetaldehyde biosynthesis I (1/1 steps found)
• phytol degradation (3/4 steps found)
• salidroside biosynthesis (3/4 steps found)
• L-isoleucine degradation II (2/3 steps found)
• L-leucine degradation III (2/3 steps found)
• L-methionine degradation III (2/3 steps found)
• L-valine degradation II (2/3 steps found)
• ethanol degradation I (1/2 steps found)
• 4-chlorocatechol degradation (3/5 steps found)
• phenylethanol biosynthesis (3/5 steps found)
• 2,4,6-trichlorophenol degradation (5/8 steps found)
• 3,5-dichlorocatechol degradation (5/8 steps found)
• butanol and isobutanol biosynthesis (engineered) (5/8 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• 4,5-dichlorocatechol degradation (4/7 steps found)
• pyruvate fermentation to ethanol I (1/3 steps found)
• pyruvate fermentation to ethanol III (1/3 steps found)
• resorcinol degradation (1/3 steps found)
• 1,4-dichlorobenzene degradation (5/9 steps found)
• 3,4,6-trichlorocatechol degradation (5/9 steps found)
• (S)-propane-1,2-diol degradation (2/5 steps found)
• 3-chlorocatechol degradation I (ortho) (2/5 steps found)
• 3-chlorocatechol degradation II (ortho) (2/5 steps found)
• acetylene degradation (anaerobic) (2/5 steps found)
• ethanolamine utilization (2/5 steps found)
• γ-resorcylate degradation I (1/4 steps found)
• γ-resorcylate degradation II (1/4 steps found)
• 4-aminophenol degradation (1/4 steps found)
• 4-sulfocatechol degradation (1/4 steps found)
• cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
• heterolactic fermentation (11/18 steps found)
• chlorosalicylate degradation (3/7 steps found)
• serotonin degradation (3/7 steps found)
• pentachlorophenol degradation (5/10 steps found)
• mixed acid fermentation (9/16 steps found)
• 4-hydroxyacetophenone degradation (1/5 steps found)
• 4-nitrophenol degradation I (1/5 steps found)
• 4-nitrophenol degradation II (1/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• 2,4,5-trichlorophenoxyacetate degradation (3/9 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (3/9 steps found)
• γ-hexachlorocyclohexane degradation (4/11 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• pinoresinol degradation (1/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (6/17 steps found)
• L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Benzoate degradation via hydroxylation
• Drug metabolism - cytochrome P450
• Fatty acid metabolism
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Metabolism of xenobiotics by cytochrome P450
• Retinol metabolism
• Tyrosine metabolism
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.3.1.32

Protein Sequence (361 amino acids)

>mRNA_3939 K13954 yiaY alcohol dehydrogenase (Rhodosporidium toruloides IFO0880)
MQPFVYNALPARVIFGWGTVSKVAEEVKRLGCSRALVLTTPQQVEAGEKVKTDLGDLAVG
IYSNATMHTPIHVTQEALAKAKELNVDCCVSVGGGSTIGLGKALALHSPDAAKIKNIVIP
TTYAGSEATPIIGQTENDKDGKPLKTTQKTMKVLPEVIIYDVDVTLSLPPQMTITSGLNA
IAHAVEALWAVEANPIISNLAIQGIEAIGRSLPLIKADSQSKDGRADALFGAWACGTCLG
AVGMSLHHKLCHTLGGSFGMPHAETHTVILPHAVAYNAPYAQDAVSRVAKALGVSNAAQG
LFDLAKDNGAPYSLKALGFKEEDLEKAADIAAKAPYPNPAPLEKAKLLQLLTNAFHGTRP
E