Protein Info for mRNA_3962 in Rhodosporidium toruloides IFO0880

Name: 12330
Annotation: K09647 IMP1 mitochondrial inner membrane protease subunit 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details TIGR02227: signal peptidase I" amino acids 28 to 189 (162 residues), 90.2 bits, see alignment E=6.6e-30 PF00717: Peptidase_S24" amino acids 51 to 108 (58 residues), 32 bits, see alignment E=9.8e-12 PF10502: Peptidase_S26" amino acids 63 to 181 (119 residues), 32.9 bits, see alignment E=5.1e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>mRNA_3962 K09647 IMP1 mitochondrial inner membrane protease subunit 1 (Rhodosporidium toruloides IFO0880)
MSAARSRFSLLSPERLQRLRRAGKFTVVTVQVLVAVHLFNQNVAEIRPCAGASMYPTLKD
EGTLVLHSPLALRLFPIERGNLVTAVSPNDPAHQILKRVIGLPGDTVCVDPSGERKKTDA
EWRKTPVGRVKGDVDPAGEWRRTDVEWCTVPPGHVWIAGDNTSNSTDSRDYGPVPIGLLK
GKIICRIWPNPGPLNTTFHKVNRA