Protein Info for mRNA_3990 in Rhodosporidium toruloides IFO0880

Name: 12358
Annotation: K07561 DPH1, dph2 2-(3-amino-3-carboxypropyl)histidine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 TIGR00322: diphthamide biosynthesis enzyme Dph1/Dph2 domain" amino acids 75 to 187 (113 residues), 139.1 bits, see alignment E=1.1e-44 amino acids 248 to 435 (188 residues), 93.4 bits, see alignment E=9e-31 amino acids 460 to 511 (52 residues), 49 bits, see alignment 2.9e-17 PF01866: Diphthamide_syn" amino acids 98 to 188 (91 residues), 116 bits, see alignment E=1.2e-37 amino acids 250 to 435 (186 residues), 117.4 bits, see alignment E=4.5e-38 amino acids 459 to 519 (61 residues), 59.4 bits, see alignment E=2.1e-20

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (594 amino acids)

>mRNA_3990 K07561 DPH1, dph2 2-(3-amino-3-carboxypropyl)histidine synthase (Rhodosporidium toruloides IFO0880)
MAAEPARNAATATIDTPSEAPKLPRKRFVGRSSTASPRPSTSSATPVVAASALQQQQEVD
PLLQAAIKHLLPSNYNFEIPKSVAQIRKNGAKRVALQMPEGLAMYGCALVDIIERFAECE
CVIMGDVTYGACCIDDYTARALGCDMMIHYGHSCLVPVDTTTIKTLYVFVEISVDRPHLA
ATVRLNFPHCIPSRSLPDSGSAKGKGPELEIAIEPRSSSACSAGGCGSCGCAKSSSAPAP
PATNEKKADGVTKLAVVGTIQFVAAVQGLKADLEAEEAAQVERLAIEAAPSSDDGAKAAE
AEQPKKERFEIVVPQVKPLSPGEILGCTAPRLASDIDALLYVGDGRFHLESIMIANPTVP
AFRYDPYTKRLTRELYDHEEMRRVRGQAVAQARESLVENGKKQEEDEKEAWAVVLGTLGR
QGNLRVLKSVTRHLEGPPSSASTAIVPTSPSVLTSSTPFIPILLSELSPAKLSLLRGVST
FVQTSCPRLSIDWGYAFTRPLLSSYEASVALGAQGARGWKHMGLDDVPAPRRAELENGRK
GDEDYPMDFYADASLGEWTPRFGMGVRRAGGEKGRPVPRRKREQQPQPQAVPVA