Protein Info for mRNA_4022 in Rhodosporidium toruloides IFO0880

Name: 12390
Annotation: KOG2661 Peptidase family M48

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 118 to 137 (20 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 271 to 296 (26 residues), see Phobius details PF01435: Peptidase_M48" amino acids 187 to 364 (178 residues), 112.5 bits, see alignment E=1.2e-36

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>mRNA_4022 KOG2661 Peptidase family M48 (Rhodosporidium toruloides IFO0880)
MPRPRLQPLLRPLFTSPLPSSFLPKPHLLPRPRPLTSSAAQQVRYRRFGDPPNRGESPAY
PPRDAEPPLRDVNPNDPLGIFDVARRRRQVPVYEQPRQRSSYGGRRQGFSFHNVQTVLRS
RMFLVLLGGAGGYYVFHLEKVPETGRWRFMDVSPSMEKQMGEQAFQETMGEFGRKVLPDY
HPQARFVQGVVQRIIRANGLEDKVGGPGWKTYVVKDDSTKNAFVLPNGTIFVFTGILPVA
ADADGLACVLGHEIAHQVARHSAERMSGMKVFYALALLLSSFGIDMGLSQVLLQFVYSLP
NSRKNETEADLIGLRLANQACFDPRAAEALWKRMSAAEDSPGVDMSFLSTHPSSKHRIEN
VRGWAEDVVKERPSECGPLRDQVEPFQRFSRARW