Protein Info for mRNA_4023 in Rhodosporidium toruloides IFO0880

Name: 12391
Annotation: K01061 E3.1.1.45 carboxymethylenebutenolidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01738: DLH
  • amino acids 30 to 248 (219 residues), 76.3 bits, E=2.7e-25
• PF02129: Peptidase_S15
  • amino acids 100 to 150 (51 residues), 22.3 bits, 9e-09

Best Hits

Swiss-Prot: 52% identical to DLHH_YEAST: Putative carboxymethylenebutenolidase (YDL086W) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 56% identity to cnb:CNBA6220)

Predicted SEED Role

No annotation

MetaCyc Pathways

• 4-chlorocatechol degradation (3/5 steps found)
• 3,5-dichlorocatechol degradation (5/8 steps found)
• 4,5-dichlorocatechol degradation (4/7 steps found)
• 1,4-dichlorobenzene degradation (5/9 steps found)
• 3,4,6-trichlorocatechol degradation (5/9 steps found)
• 3-chlorocatechol degradation I (ortho) (2/5 steps found)
• 3-chlorocatechol degradation II (ortho) (2/5 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Fluorobenzoate degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.45

Protein Sequence (269 amino acids)

>mRNA_4023 K01061 E3.1.1.45 carboxymethylenebutenolidase (Rhodosporidium toruloides IFO0880)
MLIEQTQVTVQTATGDLAIEIVKPKIAGYPNARFPGVVVWSEIYNVTGPVLRFANQIAAQ
GFIVACPYPFHELSGNVPIPYDTKGTDEGNAYKVKKLLSATDEDIKKTIDTLVAHPNCTG
QIGATGMCYGGHLAFRTALDPRCKAAVCYFATDIHSSSLSPSGDDSLDKASRGEIKGEVV
MIFGTQDGHVPLAGRTLIRDRLTNAGTKLSFLELQANHAFIRDEMSKGRFDAAISKVCFE
LLLETFTRTIGRDLGEPVEETKGDGKLVC