Protein Info for mRNA_4068 in Rhodosporidium toruloides IFO0880

Name: 12436
Annotation: K02575 NRT, narK, nrtP, nasA MFS transporter, NNP family, nitrate/nitrite transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 308 to 332 (25 residues), see Phobius details amino acids 351 to 375 (25 residues), see Phobius details amino acids 387 to 406 (20 residues), see Phobius details amino acids 412 to 436 (25 residues), see Phobius details amino acids 446 to 468 (23 residues), see Phobius details amino acids 474 to 494 (21 residues), see Phobius details TIGR00886: nitrite transporter" amino acids 33 to 459 (427 residues), 336.3 bits, see alignment E=1.2e-104 PF07690: MFS_1" amino acids 39 to 227 (189 residues), 74.5 bits, see alignment E=4.1e-25

Best Hits

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>mRNA_4068 K02575 NRT, narK, nrtP, nasA MFS transporter, NNP family, nitrate/nitrite transporter (Rhodosporidium toruloides IFO0880)
MFSLFCFGAPPVDPATQKALALPIVNPLDRHGRIFFFAWLSFLLSFLSWYAMPPLLNATI
KRDLDLSDDEVANSNIIAGVASLIVRLIAGPLCDRFGPRYVLVGTLFLSAIPGGAAGTAR
NATGLYFIRFFMGIAGAAFVPCQALMAAWFNKRVIGTASAFAAGWGDAGVGVTFFVMPAV
FNSFLANHNQPEHIAWRLGFIVPSILLIVCGIAVLALNDDTPTGSWSTRNLNISRQSTQS
VVESAYSSTTLLARPPLVHHKTPKAHQDLEKGQATVSEVRRCRSDSQDTAGASIQPTDRR
HPLRDLCCLQTLMLAAAYASTFGTTLISNSILVDWYMSKFGWQQGEASKWAALFGLLNVV
ARPFGGLMADVWFRVLGEQRGLHAKKFWMSALCVLGGAFALLVGLLNPNSPAILILLTSL
LAISIEAGNGAIYALVPHVNPHINGLMGGITGASGNLGGIVFSVIARYSSFSKTVWITGA
CGIAIGLLITPIPPLPKRMRGGQ