Protein Info for mRNA_4078 in Rhodosporidium toruloides IFO0880

Name: 12446
Annotation: K15113 SLC25A28_37, MFRN solute carrier family 25 (mitochondrial iron transporter), member 28/37

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details PF00153: Mito_carr" amino acids 16 to 104 (89 residues), 76.5 bits, see alignment E=6.3e-26 amino acids 112 to 197 (86 residues), 69.6 bits, see alignment E=8.8e-24 amino acids 202 to 295 (94 residues), 77.2 bits, see alignment E=3.8e-26

Best Hits

Swiss-Prot: 48% identical to MFRN2_DANRE: Mitoferrin-2 (slc25a28) from Danio rerio

KEGG orthology group: K15113, solute carrier family 25 (mitochondrial iron transporter), member 28/37 (inferred from 70% identity to uma:UM01059.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>mRNA_4078 K15113 SLC25A28_37, MFRN solute carrier family 25 (mitochondrial iron transporter), member 28/37 (Rhodosporidium toruloides IFO0880)
MEVIEEVDYEGLSTDSLAINMLAGSLAGIAEHAAMFPVDMIKTRMQVLSTSPSAAYASMS
DAFTRISTTEGTKRMWRGVASVILGAGPAHAVYFGMYELAKDLAGGNEGGYSFLATAGAG
AVATITSDALMNPFDVVKQRMQAHGSNFRTVADTFRTVYKTEGLAAFYVSYPTTLTMTVP
FTAVQFSTYEFIKDKLNPANTYSPITHVTAGGIAGAVAAAVTTPLDVCKTLLQTRGLSDD
KQIRNARGMGDAFRIIYQRQGLGGFARGMTPRVLTNMPSNALCWLSYEGFRFFLKGGHNK
PPPPSALVRD