Protein Info for mRNA_4081 in Rhodosporidium toruloides IFO0880

Name: 12449
Annotation: K09385 FOXG forkhead box protein G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 76 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00250: Forkhead" amino acids 1 to 76 (76 residues), 107.8 bits, see alignment E=1.4e-35

Best Hits

KEGG orthology group: K09405, forkhead box protein L (inferred from 58% identity to mbr:MONBRDRAFT_3671)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (76 amino acids)

>mRNA_4081 K09385 FOXG forkhead box protein G (Rhodosporidium toruloides IFO0880)
PPFSYAALIGQALFSTPDLRMALADIYVWIMQTYPFFKKGDAGWQNSIRHNLSLNPCFIK
TARGPDNPGKGCLWAI