Protein Info for mRNA_4102 in Rhodosporidium toruloides IFO0880

Name: 12470
Annotation: K01889 FARSA, pheS phenylalanyl-tRNA synthetase alpha chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 PF18553: PheRS_DBD3" amino acids 102 to 161 (60 residues), 69.7 bits, see alignment E=4.2e-23 TIGR00468: phenylalanine--tRNA ligase, alpha subunit" amino acids 189 to 512 (324 residues), 362.5 bits, see alignment E=1.1e-112 PF01409: tRNA-synt_2d" amino acids 237 to 511 (275 residues), 297.8 bits, see alignment E=1.3e-92 PF00152: tRNA-synt_2" amino acids 360 to 407 (48 residues), 20.1 bits, see alignment 6.2e-08 PF17759: tRNA_synthFbeta" amino acids 373 to 483 (111 residues), 25.2 bits, see alignment E=2.1e-09

Best Hits

Swiss-Prot: 55% identical to SYFA_ARATH: Phenylalanine--tRNA ligase alpha subunit, cytoplasmic (At4g39280) from Arabidopsis thaliana

KEGG orthology group: K01889, phenylalanyl-tRNA synthetase alpha chain [EC: 6.1.1.20] (inferred from 64% identity to mgl:MGL_3873)

Predicted SEED Role

"Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.20

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (524 amino acids)

>mRNA_4102 K01889 FARSA, pheS phenylalanyl-tRNA synthetase alpha chain (Rhodosporidium toruloides IFO0880)
MSVLPPAETLQSVVLHTLDQRGSIPDTRSLALALPAGVDASAQLPQLDAPEAAVVGPSVD
SQNALKAVLDSLAAREMVTFRQVNVDQHVLTAEGSQIAQSGSHEYRVWSALPPPASETGL
TAKEIEAKVGKDTAKVGQGKAMKNKWVVKKGDGFLQAVASVDDVTQKDLLAIQSSGGHSD
EKLLAELRKRKLIEKKKTFYYSVEKGPNFATTVAKLETDLTVELLSSGAWQQASFKKYNF
EAEGAPTFGGALHPLMKVREEFRNIFFEMGFTEMPTNRFVESSFWNFDTLYVPQQHPARE
MQDTFYVKDPVESTGFPEDYYERVKRVHEVGDYGSTGYRYPFSKEETSRLVLRTHTTSVS
SAQLYQLANQPGGFKPAKMFSIDRVFRNEAVDMTHLAEFHQVEGVVADYNLTLADLIGFM
EVFFSKMGVKNLRFKPAYNPYTEPSLEIFSWHEGLGKWVEIGNSGMFRPEMLETMGLPAD
VRVLGFGLSLERPTMIRYGISNIRDLLGHKVPLEMIEKSAAVRF