Protein Info for mRNA_4123 in Rhodosporidium toruloides IFO0880

Name: 12491
Annotation: KOG4510 Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 transmembrane" amino acids 140 to 160 (21 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details amino acids 420 to 438 (19 residues), see Phobius details PF00892: EamA" amino acids 139 to 274 (136 residues), 44.5 bits, see alignment E=9e-16 amino acids 302 to 434 (133 residues), 34.8 bits, see alignment E=9.2e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>mRNA_4123 KOG4510 Permease of the drug/metabolite transporter (DMT) superfamily (Rhodosporidium toruloides IFO0880)
MGLATPPSPSSKVRLQDSPLSAPSAAPAAFAPRRDSETTPTSRWQGAIEDSEDEGQDDEV
ALAGRMTESKGHRSRPSTSRLLDEDPQTDETAFSPDTLRRQRRMRSYADDETFDVGAYVP
AGARRFGLAARAVVRKNEGLLLIVASQVGFAIINTCVKLLEEDVAVPVYELIVIRMLITF
AGCYAYLRWWARDPHPFLGPPGVRLLLCLRGFVGFFGLYTNYAALQYLSLADASTLWFVS
PVLVGIQGWLILGEPYTRLEALVGIASLSGTIFIAKPSFLFPSSAVATALTAAADSSPDQ
RMKGVSIILFGVIASSSVSIIIRFIGTRASALHSISYFSLYSVLVSSLYPFVFDSPPVFR
LTTRFFVLLCPIGVLGFLSQALMTMGLIKEKAGRGALATYTNLLFTMIMERLVFGKLPDI
WSLIGAAIIVGGAIRVALEHKAHAPPSGSAVDGVDEVAVAAAAGPAMEGYDPLVMAEEGS
GGREKTATA