Protein Info for mRNA_4147 in Rhodosporidium toruloides IFO0880

Name: 12515
Annotation: HMMPfam-NAD(P)-binding Rossmann-like domain-PF13450,PRINTS-Adrenodoxin reductase family signature-PR00419,SUPERFAMILY--SSF51905

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 132 to 152 (21 residues), see Phobius details amino acids 460 to 483 (24 residues), see Phobius details amino acids 496 to 513 (18 residues), see Phobius details PF00890: FAD_binding_2" amino acids 12 to 51 (40 residues), 21 bits, see alignment 6.6e-08 PF13450: NAD_binding_8" amino acids 14 to 84 (71 residues), 47.6 bits, see alignment E=6.6e-16 PF01593: Amino_oxidase" amino acids 20 to 260 (241 residues), 30.5 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: None (inferred from 57% identity to ncr:NCU01089)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (520 amino acids)

>mRNA_4147 HMMPfam-NAD(P)-binding Rossmann-like domain-PF13450,PRINTS-Adrenodoxin reductase family signature-PR00419,SUPERFAMILY--SSF51905 (Rhodosporidium toruloides IFO0880)
MPSSSTPQKKRVLVVGAGAAGMSCAEQLSRHPDKFDVTLVESQDYCGGQAFSIDLDEKKF
GAKWMNQGVQGGSWIYHHTFHMFKQQGYEAKPVDLEVSFGKGEHFWTNVFPTVLVEKHAK
EIKRFKYALKIMRWFELFFAIIPIKVSLKMFFFSDEFIHRMIYPSLALFLGTGNATPDLP
TIMLERLYTSPTYGMWYPADDKSLSSHKPPMVVFPNETEFYTKWQHDLESRGVNVRLNTE
VTSVIERSSKRVRVTVRGRRPQPDHHNPVNGDQDLPEKEEEYDELVLCVLADTAKILLGK
KARWIEKRILGVPKWSDDVTVTHHDLDYIRKWYEIDFPPELAVKKLGNRDETDRYEAGKK
AFNPMYLIKECPGDPRKLEMCFDCSAFQFQLNQGKPLEDHVFQTIFLNTDHKKYWSMDEI
KKDKIIRIDWWHQLCHGWRHYAGCVPWMWLLQGKKRVRFAAAWTLVNAQQLACISGMAAA
YSLGASYPEELEQDDFALLCFRLYLLLDYQKWYKKGSNRS