Protein Info for mRNA_4150 in Rhodosporidium toruloides IFO0880

Name: 12518
Annotation: K15101 SLC25A2_15, ORNT solute carrier family 25 (mitochondrial ornithine transporter) member 2/15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 20 to 35 (16 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details amino acids 208 to 225 (18 residues), see Phobius details amino acids 272 to 287 (16 residues), see Phobius details PF00153: Mito_carr" amino acids 17 to 103 (87 residues), 64.1 bits, see alignment E=4.5e-22 amino acids 111 to 200 (90 residues), 51.7 bits, see alignment E=3.6e-18 amino acids 205 to 297 (93 residues), 73.2 bits, see alignment E=6.9e-25

Best Hits

KEGG orthology group: K15109, solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29 (inferred from 54% identity to cne:CNN02270)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>mRNA_4150 K15101 SLC25A2_15, ORNT solute carrier family 25 (mitochondrial ornithine transporter) member 2/15 (Rhodosporidium toruloides IFO0880)
MDSQELPTQPPPATRPVSTAASLIAGSVGGMAQVISGNPLDVLKTRSQLAAPGQFKGTLD
LATQTFRNEGILAFYKGVTPPLIGIAAVNSLLFASNTAARRLISPYPDRLSIGQVATAGA
MAGAVQAVLASPVEMFKVRLQAQYGPNPKRLRDIVGEMYSKYGWRQGIMRGYWITFVREI
PAYAGFYAGYEWSKRALQKNLGTDSLPVWATLSAGGVGGLGYWTACYPLDVVKSRVQNAE
LPPRGANYIVETFRTMYRQEGLRAFTAGLTPAYLRAVPAAAATFLGFELTMELLQKHTSL