Protein Info for mRNA_4164 in Rhodosporidium toruloides IFO0880

Name: 12532
Annotation: K02021 ABC.MR putative ABC transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 279 to 303 (25 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 19 to 114 (96 residues), 44 bits, see alignment E=3.6e-15 amino acids 151 to 327 (177 residues), 124.6 bits, see alignment E=9.1e-40 PF00005: ABC_tran" amino acids 397 to 545 (149 residues), 114.2 bits, see alignment E=1e-36

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (637 amino acids)

>mRNA_4164 K02021 ABC.MR putative ABC transport system ATP-binding protein (Rhodosporidium toruloides IFO0880)
MGEVRRLLQLAKPERRTIGIAIGLLCISSGVSLSIPLGIGRIIDIFSGQASDLPVSIPTA
AGLLAVFFAAGAAANMGRTILMRISGQRIVARLREAAYSNVLRQDIGWHDLQGAATKSTT
EISGAPRPHESKEPTPPSSTAIANVKDTGVRSTGDIISRLGSDAGIVGESLTRELSEGLR
AVVTATVGIGAMLYISSKVTGVMLLIVPPISVAAVFYGRFLKKLSRRTQKAVGEMVAVSE
ERLGAIRTVQAFNAVEPAETRRFSEKVNKVFELAKTEAWASGLFFGGTGFAGNCTLIALL
TYGGSLVARGELTVGQLISLLTYTVYVGSSLVGLTSFFGTIMKGLGASSRIFELLDARPL
SVKLGVGRPLPVTTPPRRLVFDNVHFAYPSRPHSEILRGVNLTIEPGTITSIAGGSGSGK
STIANLLERFYDPSSGRILYGDENIRDFTPESWRQRIAIVPQDPALFSATIAENIAYGRP
DASRAEIEEAARLANCAFIDTLPRGFDTQVGARGAQLSGGQRQRLAIARALLQKPKILVA
DEATSALDAASESLVNEAISNISQSHQLTTILIAHRLSTLKTADKVVYMEDGVVAEQGSY
DELAREGTRFNYLIRSQLLGGPAPTTTKAPAEERVRA