Protein Info for mRNA_4201 in Rhodosporidium toruloides IFO0880
Name: 12569
Annotation: K02913 RP-L33, MRPL33, rpmG large subunit ribosomal protein L33
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 57% identical to RM39_SCHPO: 54S ribosomal protein L39, mitochondrial (mrpl39) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)
KEGG orthology group: K02913, large subunit ribosomal protein L33 (inferred from 58% identity to sbi:SORBI_09g025380)MetaCyc: 38% identical to 50S ribosomal subunit protein L33 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
No annotation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (56 amino acids)
>mRNA_4201 K02913 RP-L33, MRPL33, rpmG large subunit ribosomal protein L33 (Rhodosporidium toruloides IFO0880) MAKAKSRTILVRLLSTVGTGYAYVARRPRVAERKLAFMKYDPRAGRHVLFTEAKMK