Protein Info for mRNA_4213 in Rhodosporidium toruloides IFO0880

Name: 12581
Annotation: K01673 cynT, can carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00484: Pro_CA
  • amino acids 42 to 212 (171 residues), 133.2 bits, E=5.4e-43

Best Hits

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 39% identity to scm:SCHCODRAFT_10553)

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• cyanate degradation (3/3 steps found)
• CO₂ fixation into oxaloacetate (anaplerotic) (1/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (1/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (6/14 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/21 steps found)
• 3-hydroxypropanoate cycle (2/13 steps found)
• glyoxylate assimilation (2/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (5/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (2/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (26/57 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Protein Sequence (243 amino acids)

>mRNA_4213 K01673 cynT, can carbonic anhydrase (Rhodosporidium toruloides IFO0880)
MSSSTQLLTSILDANETYAEAFARSDPVLLQKLAKGQSPRIFWLGCSDSRVSAELATGVA
PGSIFVHRNIAQCFHPGDLSASAALAYAVHVLKVEAIIVCGHTGCGGVKAGMQAAVESKQ
REDKGEKVEPPKPGSVEDTIAKWIAPIKSLASSQLPSCTSDPLEALELAHLTDAHVRDTV
KAVADSDLVRAAWDEGRELSVHGWVYHVATAKLRDLDCGWKGVGVRADSLSRPSTYAESE
PRE