Protein Info for mRNA_4213 in Rhodosporidium toruloides IFO0880

Name: 12581
Annotation: K01673 cynT, can carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00484: Pro_CA" amino acids 42 to 212 (171 residues), 133.2 bits, see alignment E=5.4e-43

Best Hits

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 39% identity to scm:SCHCODRAFT_10553)

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>mRNA_4213 K01673 cynT, can carbonic anhydrase (Rhodosporidium toruloides IFO0880)
MSSSTQLLTSILDANETYAEAFARSDPVLLQKLAKGQSPRIFWLGCSDSRVSAELATGVA
PGSIFVHRNIAQCFHPGDLSASAALAYAVHVLKVEAIIVCGHTGCGGVKAGMQAAVESKQ
REDKGEKVEPPKPGSVEDTIAKWIAPIKSLASSQLPSCTSDPLEALELAHLTDAHVRDTV
KAVADSDLVRAAWDEGRELSVHGWVYHVATAKLRDLDCGWKGVGVRADSLSRPSTYAESE
PRE