Protein Info for mRNA_4220 in Rhodosporidium toruloides IFO0880

Name: 12588
Annotation: K19932 NCS1 neuronal calcium sensor 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 PF13833: EF-hand_8" amino acids 40 to 89 (50 residues), 25.3 bits, see alignment E=3.8e-09 amino acids 98 to 122 (25 residues), 14 bits, see alignment (E = 1.3e-05) PF13202: EF-hand_5" amino acids 66 to 86 (21 residues), 23.8 bits, see alignment (E = 8.3e-09) amino acids 104 to 123 (20 residues), 16.4 bits, see alignment (E = 1.8e-06) PF13405: EF-hand_6" amino acids 66 to 90 (25 residues), 31 bits, see alignment (E = 5.1e-11) PF00036: EF-hand_1" amino acids 67 to 90 (24 residues), 30.5 bits, see alignment (E = 5.6e-11) amino acids 101 to 127 (27 residues), 28.9 bits, see alignment 1.8e-10 PF13499: EF-hand_7" amino acids 98 to 171 (74 residues), 64.4 bits, see alignment E=3.8e-21

Best Hits

Swiss-Prot: 73% identical to NCS1_SCHPO: Calcium-binding protein NCS-1 (ncs1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 80% identity to lbc:LACBIDRAFT_311689)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>mRNA_4220 K19932 NCS1 neuronal calcium sensor 1 (Rhodosporidium toruloides IFO0880)
MGKSQSKLSPEDLADLQKNTYFDKKELQQWYKGFVKDCPSGQLNQEEFARIYKQFFPFGN
PQAFAQHVFKVFDKNGNGTIDFREFIAALSITSRGKLDEKLQWAFQLYDINNDGLITYDE
MLKIVQSIYDMTGEMVKLPPDEDTAEKRVNKIFALMDLNHDHQLTFEEFKEGSKKDPTIV
QALSLYDGLV