Protein Info for mRNA_4221 in Rhodosporidium toruloides IFO0880

Name: 12589
Annotation: HMMPfam-Sodium/hydrogen exchanger family-PF00999

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 16 to 33 (18 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details amino acids 410 to 433 (24 residues), see Phobius details amino acids 452 to 473 (22 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 23 to 349 (327 residues), 101.3 bits, see alignment E=2.8e-33

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>mRNA_4221 HMMPfam-Sodium/hydrogen exchanger family-PF00999 (Rhodosporidium toruloides IFO0880)
MSSLTAAGTVPYHEPPFTSLAVLISFLFLANVARGIANKVLYAGLLGEIAVGVIFGPVAK
ILDTEWEETFVAVGYIGLVLIVFEGGLTLQPRSFLPQLPIALITALIGILLPLAFTFALF
SGYGYPQLQAFSAGSALASTSLGTTFYVLRASGPELGTTAVGEILKGAALIDDVIALVLL
SVIQSLGTDSGGSLGWTIGRPVVASVAMAVASPVVTLWSARPLFRWRRVEDLVARGGQPA
LLFLGVAVLVAFLAIAYYAGTTKLLGAFLAGTFLSALPSPESGLSFAATWEELLVPVQEY
ILAPLFFASIGFSIPFLSLWTGRRIWRGVIYALLMALGKLLAGLPILLVDLFRSDNRDAA
LPAHPSFDLATTTGVRSNTDAEKVHKAERMSVRSFRLNTSSRFVRQTFPAAAFVGLALVA
RGEIGILVLQVAYAASTSSDNGTEVLGEEAYLVGIWAVAVCTIVGPVVFGLLVKKEGERI
KGGRWGLA