Protein Info for mRNA_4237 in Rhodosporidium toruloides IFO0880

Name: 12605
Annotation: K15100 SLC25A1, CTP solute carrier family 25 (mitochondrial citrate transporter), member 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 116 to 133 (18 residues), see Phobius details PF00153: Mito_carr" amino acids 13 to 107 (95 residues), 69.4 bits, see alignment E=1e-23 amino acids 118 to 209 (92 residues), 66.1 bits, see alignment E=1.1e-22 amino acids 219 to 311 (93 residues), 76.2 bits, see alignment E=7.6e-26

Best Hits

Swiss-Prot: 59% identical to SFC1_YEAST: Succinate/fumarate mitochondrial transporter (SFC1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K15100, solute carrier family 25 (mitochondrial citrate transporter), member 1 (inferred from 68% identity to cne:CNE02570)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>mRNA_4237 K15100 SLC25A1, CTP solute carrier family 25 (mitochondrial citrate transporter), member 1 (Rhodosporidium toruloides IFO0880)
MASASKADPKKKTPIGIHLLAGGGAGLAEALVCHPLDTIKVRMQLSKSGRKAGVKPRGFI
ATGAHIVAKESPLGLYKGLGAVVTGIVPKMAIRFASFEQYKGFLANKETGVASSSMIFLA
GLGAGVTEAVMVVCPMEVVKIRLQAQVHSMTDPLDVPKYRNAAHALFVILREEGPRTLYR
GVALTALRQATNQAANFTAYTELKRLLQKWQPEYPDGGLPAWQTSIIGLISGAVGPFTNA
PIDTIKTRIQRATALKGETAWTRFSTVAGQMFREEGPSAFYKGITPRVARVAPGQAVVFT
VYERIKRFIEKPEEINNEYSE