Protein Info for mRNA_4242 in Rhodosporidium toruloides IFO0880

Name: 12610
Annotation: K02985 RP-S3e, RPS3 small subunit ribosomal protein S3e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 TIGR01008: ribosomal protein uS3" amino acids 10 to 194 (185 residues), 236.7 bits, see alignment E=9.1e-75 PF07650: KH_2" amino acids 22 to 96 (75 residues), 49.1 bits, see alignment E=4.2e-17 PF00189: Ribosomal_S3_C" amino acids 108 to 190 (83 residues), 83.2 bits, see alignment E=1.6e-27

Best Hits

Swiss-Prot: 80% identical to RS3_SCHPO: 40S ribosomal protein S3 (rps3) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K02985, small subunit ribosomal protein S3e (inferred from 84% identity to cnb:CNBA1030)

Predicted SEED Role

"SSU ribosomal protein S3e (S3p)" in subsystem Ribosome SSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>mRNA_4242 K02985 RP-S3e, RPS3 small subunit ribosomal protein S3e (Rhodosporidium toruloides IFO0880)
MSNSQLISKRRKFVADGVFYAELSEFFSRTLSSEGYSGCEVRVTHARTEIIIRATHTQEV
LGEKGRRIRELTALVQKRFRFPEGSVELYAEKVQNRGLDAVAQCESLRYKLLGGLAVRRA
CYGVLRFVMESGAKGCEVVVSGKLRAARAKSMKFTDGFMLHSGQPARDFVDSATRHVLMR
QGVLGIKVKIMKPWDPEGRIGPAKPLPDVVTSASLAAPLLPPSRAPH