Protein Info for mRNA_4246 in Rhodosporidium toruloides IFO0880

Name: 12614
Annotation: KOG1172 Na+-independent Cl/HCO3 exchanger AE1 and related transporters (SLC4 family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 transmembrane" amino acids 127 to 148 (22 residues), see Phobius details amino acids 160 to 190 (31 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 358 to 377 (20 residues), see Phobius details amino acids 398 to 419 (22 residues), see Phobius details amino acids 506 to 530 (25 residues), see Phobius details amino acids 563 to 581 (19 residues), see Phobius details amino acids 584 to 603 (20 residues), see Phobius details PF00955: HCO3_cotransp" amino acids 92 to 262 (171 residues), 128.9 bits, see alignment E=1.3e-41 amino acids 275 to 442 (168 residues), 72.4 bits, see alignment E=1.8e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (703 amino acids)

>mRNA_4246 KOG1172 Na+-independent Cl/HCO3 exchanger AE1 and related transporters (SLC4 family) (Rhodosporidium toruloides IFO0880)
MEGHTQPTATATPATAGDSLHPHPVARTGEDNLATDSNDTARTVDSSSRTATRSPSIEST
CKGGRDGRQRRERTFSPDRRPWPERSWAYELMPFRGMYNDVRRRLPFYVSDWTEGLRPKN
WERVIGATIRMYFLNLMPCLAYIIDMYVRTDGTYGVNEGILASAIAALCFSLFSVQPLTI
VGVTGLINLFNYTTFDILRDYDVNYIQFQAWVLIWAAIMHWISAVFNLCDFTRFITDMTS
ESFGLYVGIIYIQKGVELLVYEFDAGRGQAGWFSVVVAILFALSVYFVERAGTLHFGPFW
ARKALVDYTFAAAIIFYTGFVHIPGYIKSSDIQYLPISATFRPTLDRNWVVPFWDLPVKW
VFVALPFGFLVTLLFYFDNNTSSVMAQSRGFPVKRPAGFHWDFFLLGCTTFVAGIIGLPA
PNGLVPQAPVHTEALSVTKMVPAQAELSEGGFFEGDVNRAHREADREVERGAERKPLKVV
RTRVVEQRISHFAMAMLTLGTMSRPLLVVLGLMSRAMFAGIFLVVGWGSVEGNGIVHKTL
YLLRDRRMTPSSHPLFNIKKSSIIKFIAIQWLFFAAMIAVSETIAGIAFPIFPLALIPVR
YYLVPRLFTPEELVALDAPTANSAAVLVSLGGPLQPEHGQPRAKSVENEEEKVGSQRGRT
SGWKDEEGRVEGLRRREALEREEQERGVPGGAAGLQRIVSIKR