Protein Info for mRNA_4258 in Rhodosporidium toruloides IFO0880

Name: 12626
Annotation: KOG4044 Mitochondrial associated endoribonuclease MAR1 (isochorismatase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 51 to 220 (170 residues), 110.6 bits, E=5.4e-36

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 3.3.2.1)

MetaCyc Pathways

• 2,3-dihydroxybenzoate biosynthesis (1/3 steps found)
• vibriobactin biosynthesis (1/9 steps found)
• enterobactin biosynthesis (1/11 steps found)
• bacillibactin biosynthesis (1/12 steps found)
• superpathway of chorismate metabolism (28/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Biosynthesis of siderophore group nonribosomal peptides

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.2.1

Protein Sequence (262 amino acids)

>mRNA_4258 KOG4044 Mitochondrial associated endoribonuclease MAR1 (isochorismatase superfamily) (Rhodosporidium toruloides IFO0880)
MKSARNSLPRFPDRHDAAWLALPRPRSLSHPSLSHCLRTMSPVRKIVPNKTAFFVCDIQE
RFRLVIHAYPAVIATAEKMLKAAKLMDVPVIATEQNPKAAPPRPNPHAPKTALVALGATV
PLPLLDLPSHLRPSWVPLAKTKFSMIVPQVEQQLKEWETKSVVLMGIESHVCVLQTALDL
LERDIDVHVLADGISSCNGDEVGIAIKRMRDAGAQITTSESILFQIMQDAAHPGFKAMAG
LVKEHKEMTKDALEKLIAGRGF