Protein Info for mRNA_4278 in Rhodosporidium toruloides IFO0880

Name: 12646
Annotation: HMMPfam-Voltage-dependent anion channel-PF03595

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 73 to 93 (21 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 180 to 202 (23 residues), see Phobius details amino acids 214 to 238 (25 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 293 to 304 (12 residues), see Phobius details amino acids 331 to 360 (30 residues), see Phobius details amino acids 377 to 400 (24 residues), see Phobius details amino acids 403 to 405 (3 residues), see Phobius details amino acids 407 to 432 (26 residues), see Phobius details PF03595: SLAC1" amino acids 74 to 427 (354 residues), 265.8 bits, see alignment E=3e-83

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>mRNA_4278 HMMPfam-Voltage-dependent anion channel-PF03595 (Rhodosporidium toruloides IFO0880)
MAHSQPQLPAAPQRAVTRAPDSTEATLIGRTSSSNTAAQTDNGSVEKEISRGSMGHHPLF
ADKARGIRLRALRFTASWYSVTMGTGIVNTLLFDLPWENAHPTFRAIGSAFLIFDMVLFL
AFSILTVTRYTLYPKIFMAMLQHETHSLFLGCIPMGFVTIISGIAATGHEYGLPTLDAAL
VLYWISVGMSMLTAFGIPFVMFTQHKHTSETLTAAWLLPIVPLITEAAVGSTICKLLLLQ
NRHTYCLTLLIASYLCAGIGMLLAAAVIVLYLQRLLLHHLPPREVIVSSWLPVGPIGQGG
FALIELGQVATKLFPLIASPSRPALDFLGPAMLGSAVLTGLLLWGLGIWFAFLAIVSIAA
QFRRTGAEGAGTAVFNMGWWAFTFPLGSLTLLTFSLATVFDSIFFKVCSTIMTFSVFSLW
CIVFVPTCIGFFRGTLFAAPCLQALPKEYVDKLAPAEGGPKLRKEEQQAKASA