Protein Info for mRNA_4285 in Rhodosporidium toruloides IFO0880

Name: 12653
Annotation: K18162 NDUFAF5 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF13489: Methyltransf_23" amino acids 74 to 234 (161 residues), 55.7 bits, see alignment E=1.7e-18 PF01209: Ubie_methyltran" amino acids 83 to 199 (117 residues), 21.3 bits, see alignment E=4.5e-08 PF13847: Methyltransf_31" amino acids 86 to 188 (103 residues), 33.2 bits, see alignment E=1.3e-11 PF13649: Methyltransf_25" amino acids 87 to 180 (94 residues), 50.9 bits, see alignment E=6.4e-17 PF08242: Methyltransf_12" amino acids 88 to 182 (95 residues), 44.1 bits, see alignment E=8.7e-15 PF08241: Methyltransf_11" amino acids 88 to 183 (96 residues), 56.2 bits, see alignment E=1.4e-18

Best Hits

Swiss-Prot: 50% identical to NDUF5_RAT: Arginine-hydroxylase NDUFAF5, mitochondrial (Ndufaf5) from Rattus norvegicus

KEGG orthology group: None (inferred from 59% identity to cci:CC1G_01401)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>mRNA_4285 K18162 NDUFAF5 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 (Rhodosporidium toruloides IFO0880)
MASLTRSGPTTTLRTALRQPNRAYAVPSFAPASASPFAVFDRQLKRAQRDRAARNVERSR
LTDYVKDDVAQGMVDRLLDITRRYPVVLDVGSGPGYLAKHLDPEITQKVVMVDSSKEMLY
RDKDVETEVPVERIHLDEEQLSSHFDENSYDCVMSCLSMHWINDLPGTLIQIKRTLRPDG
VFIGSMFGGDTLFELRTALQLAEVEREGGISPRVSPMTDSQSVTSLLNRAGFSLSTVDVD
EIQIAYPSIFELIDDLKWMGEGNAVVNRRKRLDPETLLAAGEIYKELHGLEDGSIPATFQ
IMHMIGWKPDPSQPKPATRGSGTTNLADVIGDEGHKPLGDS