Protein Info for mRNA_4325 in Rhodosporidium toruloides IFO0880

Name: 12693
Annotation: K03231 EEF1A elongation factor 1-alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 TIGR00483: translation elongation factor EF-1, subunit alpha" amino acids 1 to 442 (442 residues), 761.2 bits, see alignment E=1.1e-233 PF00009: GTP_EFTU" amino acids 7 to 232 (226 residues), 185.9 bits, see alignment E=9.4e-59 PF03144: GTP_EFTU_D2" amino acids 258 to 324 (67 residues), 51.5 bits, see alignment E=1.6e-17 PF03143: GTP_EFTU_D3" amino acids 332 to 439 (108 residues), 140.1 bits, see alignment E=5.6e-45

Best Hits

Swiss-Prot: 90% identical to EF1A_PUCGR: Elongation factor 1-alpha (TEF) from Puccinia graminis

KEGG orthology group: K03231, elongation factor 1-alpha (inferred from 89% identity to scm:SCHCODRAFT_84142)

Predicted SEED Role

"Translation elongation factor 1 alpha subunit" in subsystem Translation elongation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>mRNA_4325 K03231 EEF1A elongation factor 1-alpha (Rhodosporidium toruloides IFO0880)
MGKEKGHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVL
DKLKAERERGITIDIALWKFETPKYMITVIDAPGHRDFIKNMITGTSQADCAILIIAAGT
GEFEAGISKDGQTREHALLAFTLGVRQLIVAINKMDTTKYSEARYEEIIKETSNFIKKVG
FNPKGVPFVPISGWHGDNMIEATTNMPWYKGWKKETKSGEVTGKTLLDAIDAIEPPSRPT
DKPLRLPLQDVYKIGGIGTVPVGRVETGTIKAGMVVTFAPSNVTTEVKSVEMHHEQLEAG
LPGDNVGFNVKNVSVKDIRRGNVCGDSKNDPPKEAASFKAQVIVMNHPGQIGNGYAPVLD
CHTAHIACKFDTLLEKIDRRSGKSVEDLPKFIKSGDAAIVKMVPSKPMCVESFAEYPPLG
RFAVRDMRQTVAVGVIKAVEKTDGKGGKVTKSAEKAAGKKK