Protein Info for mRNA_4336 in Rhodosporidium toruloides IFO0880

Name: 12704
Annotation: K05863 SLC25A4S, ANT solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 115 to 135 (21 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details PF00153: Mito_carr" amino acids 10 to 104 (95 residues), 77.1 bits, see alignment E=4e-26 amino acids 114 to 208 (95 residues), 84 bits, see alignment E=2.9e-28 amino acids 216 to 304 (89 residues), 57.8 bits, see alignment E=4.4e-20

Best Hits

Swiss-Prot: 76% identical to ADT_NEUCR: ADP,ATP carrier protein (aac) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

KEGG orthology group: K05863, solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31 (inferred from 82% identity to cnb:CNBM0940)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>mRNA_4336 K05863 SLC25A4S, ANT solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31 (Rhodosporidium toruloides IFO0880)
MAKKSKTPQEFFTDFMMGGVSAAVAKTAAAPIERIKLLVQNQGEMLKSGRLATPYKGIAD
CAARTYADEGLVSFWRGNTANVIRYFPTQALNFAFKDYYKSLFSYDQKRDGYTKWMLGNL
ASGGAAGATSLLFVYSLDYARTRLAADNKSAKKGGGERQFNGLLDVYKKTLASDGVAGLY
RGFVPSVVGIIVYRGLYFGMYDSLKPVVVSGSLQGSFLASFLLGWGVTTGAGLASYPLDT
IRRRMMMTSGEKVHYSSMFDAGRQIVKAEGMGSLFKGAGANILRGVAGAGVLSLYDKLQE
LMFGKVYSGGSG