Protein Info for mRNA_4365 in Rhodosporidium toruloides IFO0880

Name: 12733
Annotation: HMMPfam-Zinc finger, C3HC4 type (RING finger)-PF13920

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 896 transmembrane" amino acids 104 to 126 (23 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 247 to 265 (19 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 308 to 334 (27 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details amino acids 404 to 423 (20 residues), see Phobius details amino acids 618 to 631 (14 residues), see Phobius details PF13920: zf-C3HC4_3" amino acids 825 to 888 (64 residues), 27.4 bits, see alignment 1.2e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (896 amino acids)

>mRNA_4365 HMMPfam-Zinc finger, C3HC4 type (RING finger)-PF13920 (Rhodosporidium toruloides IFO0880)
MDDLDLTQTYSYRGVRFLRSAASRAGSLVLAPPRYAATRLVPDRVRGWMPSVLLSEGGGG
AVAGGMSGMGGSAGSAATAAASGAAEGAGAAGAQGPADAAAYVLPAPITFLTSPYLLVSI
ALGFFLHRVHHLVPPRDAISPTAAQRQGVRQRGLERVLSLPVQLGVRIPALLLVLRTCVA
LALAIAVNKGWTEAAWLGKDVEAGVIGGIARTCAKMLVWSTAWAGKGPLGKLVSSGAAAS
ALEHSSLLWQTYVAVAVSMTCENFVRSLADDLPSPSHMNLLSFAFLLHINSYGTTGAGTS
IKGSTQTYLYLLICLLEILTLQTSYALPAIRLAYSRHPITLQQRRRILTARSSRLAITAF
YSFVGQAFAMRAWAHLFGFVSAGSTEDVEEVIAGPVWLNKLPEVVFEVVVGLSVALRLAA
ALIRGEELTFNNLVGQPATAPSPDEDYAIALVKYTTHILSSTRLSGLAYELSPLEVLPLS
ISTTLESIGFIDPPPCDDLECPVHGAENREKERKRRDARSAGETGEVILRRNGEVVIFDR
VGASGSSTIKRRRVAGEADERGFEREIGRVVVEPNRSELLPRFEYDEAIDEALDRDFEVE
QDLVGGSRRIVWRRFWRVLFRVGFYVVYRALRAVKVGVAKVTGWGRDEGAMQEGWRVQAR
GRSRSCTPAAQGEEDEDDEDYSPNESDEEEDSPVLLYDGMTDAWEEMRSVHSDEAEDEVD
PMTLFSDLSADASHSSATAPTPQELAPYLLAHHLSGSSTPLTRRRYRALLPSSSNSPSPG
PSNSLAALSTAISHRRSKIVESAPHGDVERWMEEKREEWRESRSRFCVVCTVEERTIVLW
PCRCLCLCDSCRTTLSERSTIASLDNADAAGGTGRGNALCPTCRTPVQGFSRIFVP