Protein Info for mRNA_4370 in Rhodosporidium toruloides IFO0880

Name: 12738
Annotation: HMMPfam-Purine nucleoside permease (NUP)-PF06516,PIRSF--PIRSF013171

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06516: NUP
  • amino acids 45 to 357 (313 residues), 423 bits, E=3.7e-131

Best Hits

KEGG orthology group: None (inferred from 43% identity to clu:CLUG_04733)

Predicted SEED Role

"Purine nucleoside permease"

Protein Sequence (397 amino acids)

>mRNA_4370 HMMPfam-Purine nucleoside permease (NUP)-PF06516,PIRSF--PIRSF013171 (Rhodosporidium toruloides IFO0880)
MIGALKAAAVLSLAGSSLAAPATVARSSIPSAGNELASRQVVISPKVMIISMFTPEREVW
LQPMELEVDYPFMGASPLFPNVSCRRDRTVCIVTTGEAEINAASTIMALTLSTQFDLTST
YFLIAGIAGVNPYMGTLGSAGFARFSVQSGLAYELDARQMPANWSTGYWALGTKAPGQLP
NPSDLYGTEVFELNTNLLSRVLNITSGAKLNDSTTAQEYRKRFNYAPANEPPKVYQGDAL
CSDAYFAGTLLAETWGNYTKLMTKGEGNYSTTAQEDNATLEVMVRAHKAGLVDYSRIVLL
RTASDFDRAPNATADAYTAFEAEQGGFEPAIQNLVIAGKPFVDDVVKNWDSVYAAGIAPP
AAGNGSFYGDVFGTIREGAAQARRARRSIAGKVPYSA