Protein Info for mRNA_4416 in Rhodosporidium toruloides IFO0880

Name: 12784
Annotation: K00002 AKR1A1, adh alcohol dehydrogenase (NADP+)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF00248: Aldo_ket_red" amino acids 19 to 276 (258 residues), 150.5 bits, see alignment E=3.1e-48

Best Hits

Swiss-Prot: 43% identical to GLD2_HYPJE: Glycerol 2-dehydrogenase (NADP(+)) (gld2) from Hypocrea jecorina

KEGG orthology group: None (inferred from 52% identity to ppl:POSPLDRAFT_23404)

MetaCyc: 41% identical to D-galacturonate reductase (Trichoderma reesei)
RXN-11151 [EC: 1.1.1.365]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.365

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>mRNA_4416 K00002 AKR1A1, adh alcohol dehydrogenase (NADP+) (Rhodosporidium toruloides IFO0880)
MPAFSRAFQLSKGLKIPAVGLGTWKSEPGQVREAVKVAIGAGYRHIDCAAIYGNEVEVGQ
GIKDSGIARKDLWVTSKLWNAFHQPEKVAGALEKTLKDLQLEYLDLYLMHWPVAFAEGKT
PDGKPNIDWDLTRDVTPTWREMEKLVEQGKVKNIGVSNFTIGRVKRLLEVAKIRPAANQV
ELNLHCAQPELVKWSQENNVLLESYSPLGSTGAPQMDDKVVKEIASAHGATPAQVLISWQ
AARGIVVLPKSVTPERIKSNFEEVELTTDEITRLEKRALEFGTKRTVDPSEGWGVPDLWK
DVPDAKL