Protein Info for mRNA_4427 in Rhodosporidium toruloides IFO0880

Name: 12795
Annotation: K11539 CBR4 carbonyl reductase 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF00106: adh_short" amino acids 39 to 240 (202 residues), 172.8 bits, see alignment E=1.2e-54 PF08659: KR" amino acids 40 to 202 (163 residues), 48 bits, see alignment E=2.9e-16 PF13561: adh_short_C2" amino acids 44 to 291 (248 residues), 224.6 bits, see alignment E=2.8e-70

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>mRNA_4427 K11539 CBR4 carbonyl reductase 4 (Rhodosporidium toruloides IFO0880)
MDTLWSYVAPATTTANPPAAAPTPAAPPPSSSEPLFDRAVIVTGCASGIGRAVALLLAEK
GARLALTDKDADEGRRLCSEIKETYPNVDLAYATLDVTDEEAVGRLVRSFKKSFKRLDGL
VNCAGVNLPSPEVHQVKVDLWSQTMDVNARGTFAFCKHFAAMVIADEEVADPPKGGYAVV
NIGSNASVMGLPNSSAYCASKHAVLGMSRAMAKEYAQRDIRVNVVAPGPIDTPLLHNLFD
ASNMSLDDALEQVPMHRVGQPEEVAKAVAFLLSSDSSYITGACLPVDGGWTA