Protein Info for mRNA_4449 in Rhodosporidium toruloides IFO0880

Name: 12817
Annotation: K14168 CTU1, NCS6 cytoplasmic tRNA 2-thiolation protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 PF01171: ATP_bind_3" amino acids 95 to 235 (141 residues), 50.1 bits, see alignment E=3e-17 PF16503: zn-ribbon_14" amino acids 341 to 370 (30 residues), 55 bits, see alignment (E = 4.6e-19)

Best Hits

Predicted SEED Role

"n-type ATP pyrophosphatase superfamily / TilS and TtcA-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>mRNA_4449 K14168 CTU1, NCS6 cytoplasmic tRNA 2-thiolation protein 1 (Rhodosporidium toruloides IFO0880)
MAPCSLCPPAAPRRALIRRPKTGQAVCKECFFRVFETEVHHTILGRGQGMAGVAAGLSVK
GKGRADSETGSSDQRGVEAENEPMRRGLFRRGERVAIGASGGKDSTVLAYIMTLLNKRYD
YGLDLCLLSIDEGISGYRDASLDTVKLNAQQYDLPLKILSYSELYGGWTMDKVVAEVGKK
GNCTYCGVFRRQALDRGADLLEVDHIVTGHNADDVAETVLMNVLRGDLPRLERCTAITTG
GDPSSSPRSSCRPDPDDPDESELSSLLPKTIKRSKPFKYAYEKEIVMYAYFKKLDYHSTE
CIYAPTAYRGYARALVKDLEAVRPSAIVDLVLLMWVSRAEKCERCGSLTSQKLCQACMLL
EGLNRGVARVEVR