Protein Info for mRNA_4457 in Rhodosporidium toruloides IFO0880

Name: 12825
Annotation: K14709 SLC39A1_2_3, ZIP1_2_3 solute carrier family 39 (zinc transporter), member 1/2/3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 208 to 232 (25 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 272 to 296 (25 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details amino acids 349 to 367 (19 residues), see Phobius details TIGR00820: ZIP zinc/iron transport family" amino acids 23 to 370 (348 residues), 253 bits, see alignment E=2.1e-79 PF02535: Zip" amino acids 26 to 366 (341 residues), 213.4 bits, see alignment E=2.7e-67

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>mRNA_4457 K14709 SLC39A1_2_3, ZIP1_2_3 solute carrier family 39 (zinc transporter), member 1/2/3 (Rhodosporidium toruloides IFO0880)
MSAFDAGDMAEAAEDACGPTSVGRVGLRIGAIFIILATSLVGTLFPILSKRVSVLRRAVP
GWIFEFAKFFGSGVILATGLIHLLEPAVDAIGEGSTRSAGGCINDAWGEYPYAFAICLIS
LFLTFVTQICAFRLGTARLAKLGVKASPHIHVVGHPGHVQEQDRAATIPGPAAESNGEAD
SLEKGDYAKDAEVESQHFHDASEQNPFVAQLLGVATLEFGVILHSVIIGLTLSTTEDDGF
TTLFVVIIFHQMFEGLGLGTRLSFLKLDPAWSWIPWVGALLYSLCTPIGMAVGLGVREGL
SMSGATASVTSGVLDAFSSGILLYTATVELLAHEFIFNKFYHTCSWKRLFFSLVCFAAGA
GIMALLGKWA